PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 386aa    MW: 43548.9 Da    PI: 6.3738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039610genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.7e-153784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
      Lus10039610 37 KGLWSPEEDEKLMRYMLSNGQGCWSDIARNSGLQRCGKSCRLRWINYL 84
                     678*******************************************97 PP

2Myb_DNA-binding47.73.7e-1590134147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++ E++l+++ + +lG++ W+ Ia++++ gRt++++k++w++ 
      Lus10039610  90 RGAFSPHEEDLILHFHSLLGNR-WSQIAARLP-GRTDNEIKNFWNST 134
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-233087IPR009057Homeodomain-like
PROSITE profilePS5129417.6663284IPR017930Myb domain
SuperFamilySSF466897.26E-2835131IPR009057Homeodomain-like
SMARTSM007174.9E-113686IPR001005SANT/Myb domain
PfamPF002494.7E-133784IPR001005SANT/Myb domain
CDDcd001671.98E-94084No hitNo description
PROSITE profilePS5129424.24385139IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2588140IPR009057Homeodomain-like
SMARTSM007175.1E-1589137IPR001005SANT/Myb domain
PfamPF002491.2E-1390134IPR001005SANT/Myb domain
CDDcd001671.75E-1092135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MRNPALPANH LEMVAEEHDH AHRPSVHKSS KKQKVRKGLW SPEEDEKLMR YMLSNGQGCW  60
SDIARNSGLQ RCGKSCRLRW INYLRPDLKR GAFSPHEEDL ILHFHSLLGN RWSQIAARLP  120
GRTDNEIKNF WNSTLKKKMK SMNDNDNNNN NNGSPVSTWN TNNTTSSPVD NDHNGMMMTS  180
GRNVPLLFHE HDDDLIMATT TTMFNADNSL SSSSSTPSSS SSWSSQQYPK IANQCSLGSI  240
QNSTIPSSTK FLTHETGIFP QQCHENDGFV FQLPIYSDYI HHPSTRNEIS NLERESGRVT  300
SQVVNEDDQL LLFRAADDHN LVINDQWQQL GASGTSTGDD HYHFSSSCTT SWDLDGFMST  360
MDNSHYPTTN VSSFPSSFLD YQVEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25371417110B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-69myb domain protein 46